PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02020.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 289aa    MW: 31618.4 Da    PI: 8.1249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02020.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.24.3e-093885247
                                  SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                                  ++WTteE + + ++ ++   +   +W+++a++++  +t  ++ ++++++
  Zmw_sc02020.1.g00130.1.am.mk 38 DAWTTEENKVFEKVLALIDRNapdRWEKVASMLP-SKTVADVMNHYNDL 85
                                  58*****************99*************.***********986 PP

2Myb_DNA-binding41.82.5e-13144188347
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   +WT++E++l++++ +++G g W+ Ia  + ++Rt+ q+ s+ qky
  Zmw_sc02020.1.g00130.1.am.mk 144 PWTEDEHKLFLQGLRKYGRGYWRNIALNFVTTRTPTQVASHAQKY 188
                                   8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.333589IPR017884SANT domain
SMARTSM007171.6E-73688IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-103892IPR009057Homeodomain-like
PfamPF002495.8E-73985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-53984IPR009057Homeodomain-like
CDDcd001677.11E-73985No hitNo description
PROSITE profilePS5129418.736137193IPR017930Myb domain
SuperFamilySSF466892.3E-16139194IPR009057Homeodomain-like
SMARTSM007171.7E-10141191IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.3E-16141191IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-10141187IPR009057Homeodomain-like
PfamPF002491.4E-11144188IPR001005SANT/Myb domain
CDDcd001679.18E-10144189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MMAETWTQML LPTTGPWFSG QSCCPWPDRH AGGGIGGDAW TTEENKVFEK VLALIDRNAP  60
DRWEKVASML PSKTVADVMN HYNDLENDVG FIEAGLVSFP HYSSSPPSSG FTLDHWDGSD  120
GGFRRGCGLK RGRGPGQERR KGVPWTEDEH KLFLQGLRKY GRGYWRNIAL NFVTTRTPTQ  180
VASHAQKYFI RLQSGGKDKR RPSIHDTTTA NLSLPNDDHG NISPSPSSAL NTASNPTGGA  240
DQFGALTDVK PFIPPFPGVA HPYANVKLGH KSSLVSGLGF DDSVLLQIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-1437105876RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970612.11e-135PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-69DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3XKK01e-135K3XKK0_SETIT; Uncharacterized protein
STRINGSi002423m1e-135(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796